Structure of PDB 3vgw Chain C

Receptor sequence

>3vgwC (length=123) Species: 9031 (Gallus gallus)

ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLH
GTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLR
SSVNDIGDDWKATRVGINIFTRL

3D structure

• PDB: 3vgw Rational development of caged-biotin protein-labeling agents and some applications in live cells
• Chain: C
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NVZ	C	N12 L14 S16 Y33 T35 V37 A39 W70 S73 S75 T77 W97 N118	N12 L14 S16 Y33 T35 V37 A39 W70 S73 S75 T77 W97 N118	MOAD: Ka=200000M^-1

Gene Ontology

Molecular Function

• GO:0009374 biotin binding

Biological Process

• GO:0019731 antibacterial humoral response

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3vgw, PDBe:3vgw, PDBj:3vgw
• PDBsum: 3vgw
• PubMed: 22035795
• UniProt: P02701|AVID_CHICK Avidin (Gene Name=AVD)