Structure of PDB 3vek Chain C

Receptor sequence

>3vekC (length=96) Species: 10090 (Mus musculus)

ARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLTQCTNCQTT
TTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKAS

3D structure

• PDB: 3vek GATA1 directly mediates interactions with closely spaced pseudopalindromic but not distantly spaced double GATA sites on DNA.
• Chain: C
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	R202 L214 R216 R217 Y223 N280 L284 L288 H289 R293 M297 Q303 T304 R305 R307	R2 L14 R16 R17 Y23 N66 L70 L74 H75 R79 M83 Q89 T90 R91 R93
BS02	dna	C	P213 L214 N226 L230 Y231 R239 L268 R270 R271 K287 R305 N306 R307	P13 L14 N26 L30 Y31 R39 L54 R56 R57 K73 R91 N92 R93
BS03	ZN	C	C204 C207 C225 C228	C4 C7 C25 C28
BS04	ZN	C	C258 C279 C282	C44 C65 C68
BS05	ZN	C	D218 H222	D18 H22

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006357 regulation of transcription by RNA polymerase II

External links

• PDB: RCSB:3vek, PDBe:3vek, PDBj:3vek
• PDBsum: 3vek
• PubMed: 26234528
• UniProt: P17679|GATA1_MOUSE Erythroid transcription factor (Gene Name=Gata1)