Structure of PDB 3vd6 Chain C

Receptor sequence

>3vd6C (length=96) Species: 10090 (Mus musculus)

ARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLTQCTNCQTT
TTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKAS

3D structure

• PDB: 3vd6 GATA1 directly mediates interactions with closely spaced pseudopalindromic but not distantly spaced double GATA sites on DNA.
• Chain: C
• Resolution: 1.98 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	R202 L214 R216 R217 Y223 N280 L284 H289 R293 M297 Q303 T304 R305 R307	R2 L14 R16 R17 Y23 N66 L70 H75 R79 M83 Q89 T90 R91 R93
BS02	dna	C	P213 N226 L230 R239 L268 R270 R271 K287 R305 N306 R307	P13 N26 L30 R39 L54 R56 R57 K73 R91 N92 R93
BS03	ZN	C	C204 C207 C225 C228	C4 C7 C25 C28
BS04	ZN	C	C258 C261 C279 C282	C44 C47 C65 C68
BS05	ZN	C	D218 H222	D18 H22

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006357 regulation of transcription by RNA polymerase II

External links

• PDB: RCSB:3vd6, PDBe:3vd6, PDBj:3vd6
• PDBsum: 3vd6
• PubMed: 26234528
• UniProt: P17679|GATA1_MOUSE Erythroid transcription factor (Gene Name=Gata1)