Structure of PDB 3vbi Chain C

Receptor sequence

>3vbiC (length=186) Species: 699184 (Bacillus cereus SJ1)

MNSFYSQEELKKIGFLSVGKNVLISKKASIYNPGVISIGNNVRIDDFCIL
SGKVTIGSYSHIAAYTALYGGEVGIEMYDFANISSRTIVYAAIDDFSGNA
LMGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMV
KESLDDWYIYVGVPVRKIKARKRKIVELENEFLKSM

3D structure

• PDB: 3vbi Structural Studies of AntD: An N-Acyltransferase Involved in the Biosynthesis of d-Anthrose.
• Chain: C
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	0FX	C	Y31 S51 Y69 D94	Y31 S51 Y69 D94
BS02	COA	C	Y90 I93 F96 F133 M149 K151 V163	Y90 I93 F96 F133 M149 K151 V163
BS03	0FX	C	N2 S3 R43 D45 D46 H61	N2 S3 R43 D45 D46 H61
BS04	COA	C	S84 G145 A146 V161 K169	S84 G145 A146 V161 K169

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 03:18:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3vbi', asym_id = 'C', title = 'Structural Studies of AntD: An N-Acyltransferase Involved in the Biosynthesis of d-Anthrose.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3vbi', asym_id='C', title='Structural Studies of AntD: An N-Acyltransferase Involved in the Biosynthesis of d-Anthrose.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016740', uniprot = '', pdbid = '3vbi', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016740', uniprot='', pdbid='3vbi', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>