Structure of PDB 3v21 Chain C

Receptor sequence

>3v21C (length=288) Species: 1422 (Geobacillus stearothermophilus)

LTNSNCVEEYKENGKTKIRIKPFNALIELYHHQTPTGSIKENLDKLENYV
KDVVKAKGLAIPTSGAFSNTRGTWFEVMIAIQSWNYRVKRELNDYLIIKM
PNVKTFDFRKIFDNETREKLHQLEKSLLTHKQQVRLITSNPDLLIIRQKD
LIKSEYNLPINKLTHENIDVALTLFKDIEGKCKWDSLVAGVGLKTSLRPD
RRLQLVHEGNILKSLFAHLKMAYWNPKAEFKYYGASSEPVSKADDDALQT
AATHTIVNVNSTPERAVDDIFSLTSFEDIDKMLDQIIK

3D structure

• PDB: 3v21 Structural mechanisms of the degenerate sequence recognition by Bse634I restriction endonuclease.
• Chain: C
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E80 D146 K198 E212
• Catalytic site (residue number reindexed from 1): E76 D142 K194 E208
• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	S68 S72 R75 G76 E80 N106 V107 K108 S143 D146 K198 T199 S200 R202 R205	S64 S68 R71 G72 E76 N102 V103 K104 S139 D142 K194 T195 S196 R198 R201
BS02	dna	C	R23 I24 P26 T67 G69 A70 N73 K108 T109 P203 D204 R206 A247	R19 I20 P22 T63 G65 A66 N69 K104 T105 P199 D200 R202 A243
BS03	dna	C	R151 K231	R147 K227

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:3v21, PDBe:3v21, PDBj:3v21
• PDBsum: 3v21
• PubMed: 22495930
• UniProt: Q8RT53