Structure of PDB 3uw9 Chain C |
>3uw9C (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
PKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPM DMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEK LFLQKINELPTE |
|
PDB | 3uw9 Histone recognition and large-scale structural analysis of the human bromodomain family. |
Chain | C |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
C |
N140 D145 |
N85 D90 |
|
|
|