Structure of PDB 3uqd Chain C

Receptor sequence
>3uqdC (length=307) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
VRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHL
GGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASG
EQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQ
LISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQ
PDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQST
VGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNGTRLCSHDDTQK
IYAYLSR
3D structure
PDB3uqd Studying the phosphoryl transfer mechanism of theE. coliphosphofructokinase-2: from X-ray structure to quantum mechanics/molecular mechanics simulations.
ChainC
Resolution2.14 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G253 A254 G255 D256
Catalytic site (residue number reindexed from 1) G252 A253 G254 D255
Enzyme Commision number 2.7.1.11: 6-phosphofructokinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 F6P C K27 R29 K26 R28
BS02 ATP C S100 E102 S99 E101
BS03 ATP C Q21 Y23 G26 Q20 Y22 G25
BS04 FBP C D14 G39 N43 R90 R105 S139 G253 D13 G38 N42 R89 R104 S138 G252
BS05 ADP C K185 S224 G226 G229 M258 V280 G283 S284 K184 S223 G225 G228 M257 V279 G282 S283
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003872 6-phosphofructokinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0009024 tagatose-6-phosphate kinase activity
GO:0016301 kinase activity
GO:0016772 transferase activity, transferring phosphorus-containing groups
GO:0016773 phosphotransferase activity, alcohol group as acceptor
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0006096 glycolytic process
GO:0006974 DNA damage response
GO:0016310 phosphorylation
GO:0061615 glycolytic process through fructose-6-phosphate
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3uqd, PDBe:3uqd, PDBj:3uqd
PDBsum3uqd
PubMed30996866
UniProtP06999|PFKB_ECOLI ATP-dependent 6-phosphofructokinase isozyme 2 (Gene Name=pfkB)

[Back to BioLiP]