Structure of PDB 3und Chain C

Receptor sequence

>3undC (length=282) Species: 320372 (Burkholderia pseudomallei 1710b)

SMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIP
FVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQ
AAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHV
VSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVT
HSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRARCDG
PSALPLHQLEGLLSQMKAIDDLVKRMPALEIR

3D structure

• PDB: 3und Combining functional and structural genomics to sample the essential Burkholderia structome.
• Chain: C
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	A5P	C	K58 N60 R61 S62 H200 Q203 R205 A211 S212 D248	K59 N61 R62 S63 H201 Q204 R206 A212 S213 D249
BS02	PEP	C	K53 Q111 P113 A114 K136 R166 H200	K54 Q112 P114 A115 K137 R167 H201
BS03	KD0	C	K53 K58 N60 R61 S62 Q111 K136 H200 R205 A211 S212 D248	K54 K59 N61 R62 S63 Q112 K137 H201 R206 A212 S213 D249

Gene Ontology

Molecular Function

• GO:0008676 3-deoxy-8-phosphooctulonate synthase activity
• GO:0016740 transferase activity

Biological Process

• GO:0009058 biosynthetic process
• GO:0009103 lipopolysaccharide biosynthetic process
• GO:0019294 keto-3-deoxy-D-manno-octulosonic acid biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3und, PDBe:3und, PDBj:3und
• PDBsum: 3und
• PubMed: 23382856
• UniProt: Q3JP68