Structure of PDB 3trz Chain C

Receptor sequence

>3trzC (length=130) Species: 10090 (Mus musculus)

PQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGF
RSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSEDRCYNCGGLDHHA
KECKLPPQPKKCHFCQSINHMVASCPLKAQ

3D structure

• PDB: 3trz Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
• Chain: C
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K45 W46 F47 N48 V49 R50 M51 F53 F55 D71 F73 H75 Q76 F84 R85 S100 K102 E105 E121	K11 W12 F13 N14 V15 R16 M17 F19 F21 D37 F39 H41 Q42 F50 R51 S66 K68 E71 E87
BS02	rna	C	R138 Y140 H148 A149 K150 Q157 K159 K160 C161 H162 M170 V171 K177	R89 Y91 H99 A100 K101 Q108 K110 K111 C112 H113 M121 V122 K128
BS03	ZN	C	C139 C142 H147 C152	C90 C93 H98 C103
BS04	ZN	C	C161 C164 H169 C174	C112 C115 H120 C125

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

External links

• PDB: RCSB:3trz, PDBe:3trz, PDBj:3trz
• PDBsum: 3trz
• PubMed: 22078496
• UniProt: Q8K3Y3|LN28A_MOUSE Protein lin-28 homolog A (Gene Name=Lin28a)