Structure of PDB 3tj9 Chain C |
>3tj9C (length=154) Species: 210 (Helicobacter pylori) [Search protein sequence] |
MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLK DAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGN RHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVSM PHSE |
|
PDB | 3tj9 Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking. |
Chain | C |
Resolution | 2.521 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
H102 H152 |
H102 H152 |
|
|
|
|