Structure of PDB 3ta0 Chain C

Receptor sequence
>3ta0C (length=99) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence]
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEVDLLQKTKVEVV
VSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEVAAAH
3D structure
PDB3ta0 Mechanism of disruption of the Amt-GlnK complex by P(II)-mediated sensing of 2-oxoglutarate.
ChainC
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP C G27 M28 T29 V64 K101 R103 G27 M28 T29 V50 K87 R89
BS02 ATP C G35 R36 G37 K58 F86 G87 D88 G89 R90 G35 R36 G37 K44 F72 G73 D74 G75 R76
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ta0, PDBe:3ta0, PDBj:3ta0
PDBsum3ta0
PubMed22039461
UniProtO28524|GLNK3_ARCFU Nitrogen regulatory protein GlnK3 (Gene Name=glnK3)

[Back to BioLiP]