Structure of PDB 3t1y Chain C

Receptor sequence

>3t1yC (length=206) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVAL
NVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKV
IVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY
IFLGEV

3D structure

PDB

3t1y Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	G2 N3 K4 I5 K27 R127 S154 G155 R156 G159 E161 Q162 A163 G171 R172 V173 P174 H176 T177 L178 R179 F186 R190 T192 Y193 G194 V195 G197 K199	G1 N2 K3 I4 K26 R126 S153 G154 R155 G158 E160 Q161 A162 G170 R171 V172 P173 H175 T176 L177 R178 F185 R189 T191 Y192 G193 V194 G196 K198

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3t1y, PDBe:3t1y, PDBj:3t1y
PDBsum	3t1y
PubMed	22227389
UniProt	P80372\|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]