Structure of PDB 3stz Chain C

Receptor sequence

>3stzC (length=102) Species: 1916 (Streptomyces lividans)

ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVET
ATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
GH

3D structure

• PDB: 3stz Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
• Chain: C
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MTN	C	Q58 G79 L81 C82	Q36 G57 L59 C60

Gene Ontology

Molecular Function

• GO:0005249 voltage-gated potassium channel activity

Biological Process

• GO:0006813 potassium ion transport

Cellular Component

• GO:0008076 voltage-gated potassium channel complex

External links

• PDB: RCSB:3stz, PDBe:3stz, PDBj:3stz
• PDBsum: 3stz
• PubMed: 22771214
• UniProt: P0A334|KCSA_STRLI pH-gated potassium channel KcsA (Gene Name=kcsA)