Structure of PDB 3spl Chain C

Receptor sequence

>3splC (length=200) Species: 284812 (Schizosaccharomyces pombe 972h-)

SFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLT
HVHPLEIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALANY
IKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTS
NLPTRGTLTSLFQEDLKCWRCGETFGRHFTKLKAHLQEEYDDWLDKSVSM

3D structure

• PDB: 3spl Crystal structures of aprataxin ortholog Hnt3 reveal the mechanism for reversal of 5'-adenylated DNA
• Chain: C
• Resolution: 2.101 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.71: adenosine-5'-diphospho-5'-[DNA] diphosphatase.
  3.6.1.72: DNA-3'-diphospho-5'-guanosine diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	F34 F65 K67 S142 M143 H165 T191 F194	F2 F33 K35 S110 M111 H133 T159 F162
BS02	dna	C	F34 R209 H210 F211 T212	F2 R177 H178 F179 T180
BS03	ZN	C	C200 C203 H217 E221	C168 C171 H185 E189
BS04	AMP	C	L38 Y41 D63 M64 F65 H138 P141 S142 M143 H147 H149	L6 Y9 D31 M32 F33 H106 P109 S110 M111 H115 H117

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity

External links

• PDB: RCSB:3spl, PDBe:3spl, PDBj:3spl
• PDBsum: 3spl
• PubMed: 21984208
• UniProt: O74859|APTX_SCHPO Aprataxin-like protein (Gene Name=hnt3)