Structure of PDB 3rym Chain C |
>3rymC (length=105) Species: 266 (Paracoccus denitrificans) [Search protein sequence] |
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREA MPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFKRG KVVVE |
|
PDB | 3rym Replacement of the axial copper ligand methionine with lysine in amicyanin converts it to a zinc-binding protein that no longer binds copper. |
Chain | C |
Resolution | 1.7039 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H53 C92 H95 |
Catalytic site (residue number reindexed from 1) |
H53 C92 H95 |
Enzyme Commision number |
? |
|
|
|
|