Structure of PDB 3rod Chain C

Receptor sequence

>3rodC (length=259) Species: 9606 (Homo sapiens)

SGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLD
GVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAP
AAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAV
PLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSS
YYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGL
FSLVARKLS

3D structure

• PDB: 3rod Structural basis of substrate recognition in human nicotinamide N-methyltransferase.
• Chain: C
• Resolution: 2.72 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.1: nicotinamide N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	C	Y20 Y25 G63 S64 Y69 D85 Y86 C141 D142 V143 T163 L164 A169	Y18 Y23 G61 S62 Y67 D83 Y84 C139 D140 V141 T161 L162 A167	BindingDB: IC50=35300nM
BS02	NCA	C	Y20 Y24 L164 A168 Y204 S213 Y242	Y18 Y22 L162 A166 Y202 S211 Y240

Gene Ontology

Molecular Function

• GO:0008112 nicotinamide N-methyltransferase activity
• GO:0008168 methyltransferase activity
• GO:0030760 pyridine N-methyltransferase activity

Biological Process

• GO:0006769 nicotinamide metabolic process
• GO:0009410 response to xenobiotic stimulus
• GO:0031100 animal organ regeneration
• GO:0032259 methylation
• GO:0034356 NAD biosynthesis via nicotinamide riboside salvage pathway
• GO:0045722 positive regulation of gluconeogenesis
• GO:0090312 positive regulation of protein deacetylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3rod, PDBe:3rod, PDBj:3rod
• PDBsum: 3rod
• PubMed: 21823666
• UniProt: P40261|NNMT_HUMAN Nicotinamide N-methyltransferase (Gene Name=NNMT)