Structure of PDB 3rbm Chain C

Receptor sequence

>3rbmC (length=356) Species: 126793 (Plasmodium vivax Sal-1)

LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNN
RGILVILIYEYVKINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRR
NKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRD
ATLKTIIGQHLDTNIFSDKYSEIDVNNINVPEQPVIDINMINFGVYKNIV
IHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDYL
DIFGDSTKTGKVGSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLA
CVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLE
ILFTGV

3D structure

• PDB: 3rbm Lipophilic analogs of zoledronate and risedronate inhibit Plasmodium geranylgeranyl diphosphate synthase (GGPPS) and exhibit potent antimalarial activity.
• Chain: C
• Resolution: 2.61 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K81 A121 D126 D130 R135 D198 K243 F283 D287 D288
• Catalytic site (residue number reindexed from 1): K48 A85 D90 D94 R99 D162 K203 F243 D247 D248

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	C	D287 D305	D247 D265
BS02	MG	C	D126 D130 Q195 D198	D90 D94 Q159 D162
BS03	MG	C	D126 D130	D90 D94
BS04	B73	C	F122 A125 D126 D130 R135 V156 Q195 K243 T244 D287 K301	F86 A89 D90 D94 R99 V120 Q159 K203 T204 D247 K261
BS05	B73	C	V153 N154 L157	V117 N118 L121

Gene Ontology

Molecular Function

• GO:0004161 dimethylallyltranstransferase activity
• GO:0004337 geranyltranstransferase activity
• GO:0004659 prenyltransferase activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0045337 farnesyl diphosphate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0016020 membrane

External links

• PDB: RCSB:3rbm, PDBe:3rbm, PDBj:3rbm
• PDBsum: 3rbm
• PubMed: 22392982
• UniProt: A5K4U6