Structure of PDB 3qw1 Chain C

Receptor sequence
>3qw1C (length=106) Species: 562 (Escherichia coli) [Search protein sequence]
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNA
CHQKYR
3D structure
PDB3qw1 Templated construction of a zn-selective protein dimerization motif.
ChainC
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN C H73 H77 H73 H77
BS02 HEM C E4 M7 N11 P46 G64 F65 L68 C98 C101 H102 R106 E4 M7 N11 P46 G64 F65 L68 C98 C101 H102 R106
BS03 LCY C E81 C82 E81 C82
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 15:51:57 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3qw1', asym_id = 'C', title = 'Templated construction of a zn-selective protein dimerization motif.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3qw1', asym_id='C', title='Templated construction of a zn-selective protein dimerization motif.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005506,0009055,0020037,0022900,0042597', uniprot = '', pdbid = '3qw1', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005506,0009055,0020037,0022900,0042597', uniprot='', pdbid='3qw1', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>