Structure of PDB 3qvy Chain C

Receptor sequence

>3qvyC (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNA
CHQKYR

3D structure

• PDB: 3qvy Templated construction of a zn-selective protein dimerization motif.
• Chain: C
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ME7	C	E81 C82	E81 C82
BS02	ZN	C	H73 H77	H73 H77
BS03	HEM	C	E4 M7 N11 P46 F61 G64 F65 C98 C101 H102 R106	E4 M7 N11 P46 F61 G64 F65 C98 C101 H102 R106
BS04	ZN	C	A1 D39	A1 D39
BS05	ZN	C	E8 D12	E8 D12

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 23:46:07 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3qvy', asym_id = 'C', title = 'Templated construction of a zn-selective protein dimerization motif.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3qvy', asym_id='C', title='Templated construction of a zn-selective protein dimerization motif.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005506,0009055,0020037,0022900,0042597', uniprot = '', pdbid = '3qvy', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005506,0009055,0020037,0022900,0042597', uniprot='', pdbid='3qvy', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>