Structure of PDB 3qjr Chain C

Receptor sequence

>3qjrC (length=33) Species: 300852 (Thermus thermophilus HB8)

EEKPKGALAVILVLTLTILVFWLGVYAVFFARG

3D structure

• PDB: 3qjr Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
• Chain: C
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HAS	C	V11 L15	V10 L14

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity

Biological Process

• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:3qjr, PDBe:3qjr, PDBj:3qjr
• PDBsum: 3qjr
• PubMed: 22226917
• UniProt: P82543|COXA_THET8 Cytochrome c oxidase polypeptide 2A (Gene Name=cbaD)