Structure of PDB 3p2a Chain C |
>3p2aC (length=141) Species: 214092 (Yersinia pestis CO92) [Search protein sequence] |
MNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQ DDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALST RFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSR |
|
PDB | 3p2a Crystal Structure of Thioredoxin 2 from Yersinia pestis |
Chain | C |
Resolution | 2.195 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
C5 C8 C25 C28 |
C5 C8 C25 C28 |
|
|
|
|