Structure of PDB 3oqn Chain C

Receptor sequence

>3oqnC (length=332) Species: 1423 (Bacillus subtilis)

MNITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNA
VARGLASKKTTTVGVIIPDISSIFYSELARGIEDIATMYKYNIILSNSDQ
NMEKELHLLNTMLGKQVDGIVFMGGNITDEHVAEFKRSPVPIVLAASVEE
QEETPSVAIDYEQAIYDAVKLLVDKGHTDIAFVSGPMAEPINRSKKLQGY
KRALEEANLPFNEQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEM
ALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV
AMRLLTKLMNKEPVEEHIVELPHRIELRKSTK

3D structure

• PDB: 3oqn Structures of carbon catabolite protein A-(HPr-Ser46-P) bound to diverse catabolite response element sites reveal the basis for high-affinity binding to degenerate DNA operators.
• Chain: C
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	S16 A18 T19 R22 N29 V30 K31 T34 L56 A57 K59	S15 A17 T18 R21 N28 V29 K30 T33 L55 A56 K58	PDBbind-CN: Kd=3.0nM
BS02	dna	C	T5 I6 Y7 M17 S21 Y47 N50 A53 R54 A57	T4 I5 Y6 M16 S20 Y46 N49 A52 R53 A56	PDBbind-CN: Kd=3.0nM

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001216 DNA-binding transcription activator activity
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3oqn, PDBe:3oqn, PDBj:3oqn
• PDBsum: 3oqn
• PubMed: 21106498
• UniProt: P25144|CCPA_BACSU Catabolite control protein A (Gene Name=ccpA)