Structure of PDB 3opk Chain C |
>3opkC (length=118) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
SNAMLDVKSQDISIPEAVVVLCTAPDEATAQDLAAKVLAEKLAACATLLP GATSLYYWEGKLEQEYEVQMILKTTVSHQQALIDCLKSHHPYQTPELLVL PVTHGDTDYLSWLNASLR |
|
PDB | 3opk Crystal structure of divalent-cation tolerance protein CutA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
Chain | C |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
C |
P12 A14 V99 |
P15 A17 V102 |
|
|
|
|