Structure of PDB 3oet Chain C

Receptor sequence

>3oetC (length=372) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

SNAMKILVDENMPYARELFSRLGEVKAVPGRVEELNDALMVRSVTKVNES
LSGTPINFVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSAL
LMLAERDGFSLRDRTIGIVGVGNVGSRLQTRLEALGIRTLLCDPPRAARG
DEGDFRTLDELVQEADVLTFHTPLYKDGPYKTLHLADETLIRRLKPGAIL
INACRGPVVDNAALLARLNAGQPLSVVLDVWEGEPDLNVALLEAVDIGTS
HIAGYTLEGKARGTTQVFEAYSAFIGEQRVALETLLPAPEFGRITLHGPL
DQPTLKRLAHLVYDVRRDDAPLRKVAGIPGEFDKLRKNYLERREWSSLYV
MCDDETAAALLCKLGFNAVHHP

3D structure

• PDB: 3oet D-Erythronate-4-Phosphate Dehydrogenase complexed with NAD
• Chain: C
• Resolution: 2.36 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N91 R208 D232 E235 E237 G251 H254
• Catalytic site (residue number reindexed from 1): N88 R205 D229 E232 E234 G248 H251
• Enzyme Commision number: 1.1.1.290: 4-phosphoerythronate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	C	N91 V95 G123 G125 N126 V127 D146 P147 P148 H174 T175 P176 Y178 Y183 T185 A206 C207 H254	N88 V92 G120 G122 N123 V124 D143 P144 P145 H171 T172 P173 Y175 Y180 T182 A203 C204 H251

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0033711 4-phosphoerythronate dehydrogenase activity
• GO:0046983 protein dimerization activity
• GO:0051287 NAD binding

Biological Process

• GO:0008615 pyridoxine biosynthetic process
• GO:0036001 'de novo' pyridoxal 5'-phosphate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3oet, PDBe:3oet, PDBj:3oet
• PDBsum: 3oet
• UniProt: P60802|PDXB_SALTY Erythronate-4-phosphate dehydrogenase (Gene Name=pdxB)