Structure of PDB 3o5c Chain C

Receptor sequence

>3o5cC (length=304) Species: 70863 (Shewanella oneidensis)

EPIEVITPAITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDAL
PTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEM
GFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPN
SPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLI
KPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEE
AVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPR
PVPF

3D structure

• PDB: 3o5c Investigation of the Electron Transport Chain to and the Catalytic Activity of the Diheme Cytochrome c Peroxidase CcpA of Shewanella oneidensis.
• Chain: C
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E123
• Catalytic site (residue number reindexed from 1): E99
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	C60 C63 H64 I87 S89 P90 Q101 F102 W103 R106 Q113 P117 E123 E167 K250	C36 C39 H40 I63 S65 P66 Q77 F78 W79 R82 Q89 P93 E99 E143 K226
BS02	HEM	C	W103 C204 C207 H208 M221 F249 P252 L254 I257 Y263 F264 H265 V276 M279 A280 Q283 L284	W79 C180 C183 H184 M197 F225 P228 L230 I233 Y239 F240 H241 V252 M255 A256 Q259 L260
BS03	CA	C	N88 T260 P262	N64 T236 P238
BS04	BU3	C	E41 K44 P313 I314	E17 K20 P289 I290

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0004601 peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3o5c, PDBe:3o5c, PDBj:3o5c
• PDBsum: 3o5c
• PubMed: 21742904
• UniProt: Q8EF24