Structure of PDB 3o4r Chain C

Receptor sequence
>3o4rC (length=253) Species: 9606 (Homo sapiens) [Search protein sequence]
RRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVAT
LQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGS
IMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSP
SPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWM
DKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTP
SRL
3D structure
PDB3o4r Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
ChainC
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G43 S169 F179 Y182 K186 K227
Catalytic site (residue number reindexed from 1) G18 S144 F154 Y157 K161 K202
Enzyme Commision number 1.1.1.184: carbonyl reductase (NADPH).
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 NAP C A39 T41 D42 G43 I44 S63 R64 K65 N68 H89 N116 A118 S169 Y182 K186 G213 I215 T217 F219 A14 T16 D17 G18 I19 S38 R39 K40 N43 H64 N91 A93 S144 Y157 K161 G188 I190 T192 F194
Gene Ontology
Molecular Function
GO:0000253 3-keto sterol reductase activity
GO:0001758 retinal dehydrogenase activity
GO:0004090 carbonyl reductase (NADPH) activity
GO:0016491 oxidoreductase activity
GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0018455 alcohol dehydrogenase [NAD(P)+] activity
GO:0033703 3beta-hydroxy-5beta-steroid dehydrogenase activity
GO:0042802 identical protein binding
GO:0052650 all-trans-retinol dehydrogenase (NADP+) activity
Biological Process
GO:0006066 alcohol metabolic process
GO:0008202 steroid metabolic process
GO:0042180 cellular ketone metabolic process
GO:0042572 retinol metabolic process
GO:0042574 retinal metabolic process
GO:2000379 positive regulation of reactive oxygen species metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005777 peroxisome
GO:0005778 peroxisomal membrane
GO:0005782 peroxisomal matrix
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3o4r, PDBe:3o4r, PDBj:3o4r
PDBsum3o4r
PubMed
UniProtQ9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 (Gene Name=DHRS4)

[Back to BioLiP]