Structure of PDB 3o4k Chain C

Receptor sequence

>3o4kC (length=171) Species: 9838 (Camelus dromedarius)

EDPPACGSIVPRREWRALASECRERLTRPVRYVVVSHTAGSHCDTPASCA
QQAQNVQSYHVRNLGWCDVGYNFLIGEDGLVYEGRGWNIKGAHAGPTWNP
ISIGISFMGNYMNRVPPPRALRAAQNLLACGVALGALRSNYEVKGHRDVQ
PTLSPGDRLYEIIQTWSHYRA

3D structure

• PDB: 3o4k Structural basis of recognition of pathogen-associated molecular patterns and inhibition of proinflammatory cytokines by camel peptidoglycan recognition protein
• Chain: C
• Resolution: 2.11 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y71 T152
• Catalytic site (residue number reindexed from 1): Y71 T152

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LTC	C	E24 L64 W66 C67 A92 H93 G95 N99 Q150	E24 L64 W66 C67 A92 H93 G95 N99 Q150	MOAD: Kd=24nM PDBbind-CN: -logKd/Ki=7.62,Kd=24nM

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
• GO:0016019 peptidoglycan immune receptor activity
• GO:0042834 peptidoglycan binding

Biological Process

• GO:0001818 negative regulation of cytokine production
• GO:0009253 peptidoglycan catabolic process
• GO:0016045 detection of bacterium
• GO:0042742 defense response to bacterium
• GO:0045087 innate immune response
• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3o4k, PDBe:3o4k, PDBj:3o4k
• PDBsum: 3o4k
• PubMed: 21454594
• UniProt: Q9GK12|PGRP1_CAMDR Peptidoglycan recognition protein 1 (Gene Name=PGLYRP1)