Structure of PDB 3nmj Chain C

Receptor sequence
>3nmjC (length=106) Species: 562 (Escherichia coli) [Search protein sequence]
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNA
CHQKYR
3D structure
PDB3nmj Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
ChainC
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PXX C T44 P53 T44 P53
BS02 HEM C L3 M7 N11 F61 F65 C98 C101 H102 R106 L3 M7 N11 F61 F65 C98 C101 H102 R106
BS03 PXX C K42 P53 M58 C59 A62 K42 P53 M58 C59 A62
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0022900 electron transport chain
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3nmj, PDBe:3nmj, PDBj:3nmj
PDBsum3nmj
PubMed20740227
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)

[Back to BioLiP]