Structure of PDB 3nhz Chain C |
>3nhzC (length=118) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] |
MRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLV LLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYI MKPFKPKELVARVRARLR |
|
PDB | 3nhz Regulation of response regulator autophosphorylation through interdomain contacts. |
Chain | C |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
C |
D13 D56 M58 |
D10 D53 M55 |
|
|
|
|