Structure of PDB 3ng6 Chain C

Receptor sequence

>3ng6C (length=142) Species: 35730 (Trematomus newnesi)

SLSDKDKAAVRALWSKIGKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVT
PGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPSNFK
ILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR

3D structure

• PDB: 3ng6 An order-disorder transition plays a role in switching off the root effect in fish hemoglobins.
• Chain: C
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	M32 F43 W46 H59 K62 V63 H88 L92 L102	M32 F43 W46 H59 K62 V63 H88 L92 L102

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3ng6, PDBe:3ng6, PDBj:3ng6
• PDBsum: 3ng6
• PubMed: 20610398
• UniProt: P45718|HBA1_TRENE Hemoglobin subunit alpha-1 (Gene Name=hba1)