Structure of PDB 3ncr Chain C

Receptor sequence
>3ncrC (length=116) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence]
MKKIEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQQGGMQIQFRGRT
MEVTLLPKVKLEIVVKDDAVEEVIGLIVNSAFTGSPGDGKIFIIPVEDVV
RIRTGERGDDSLEHHH
3D structure
PDB3ncr Cooperative binding of MgATP and MgADP in the trimeric P(II) protein GlnK2 from Archaeoglobus fulgidus.
ChainC
Resolution1.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PO4 C K3 E5 K60 K3 E5 K60
BS02 ADP C G27 M28 T29 V64 G27 M28 T29 V64
BS03 ADP C G35 R36 G37 Q38 Q39 P86 G87 G89 K90 G35 R36 G37 Q38 Q39 P86 G87 G89 K90
BS04 PO4 C M1 K66 D67 M1 K66 D67
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ncr, PDBe:3ncr, PDBj:3ncr
PDBsum3ncr
PubMed20643148
UniProtO28527|GLNK2_ARCFU Nitrogen regulatory protein GlnK2 (Gene Name=glnK2)

[Back to BioLiP]