Structure of PDB 3n7s Chain C |
>3n7sC (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] |
ACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWH MAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPG |
|
PDB | 3n7s Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism. |
Chain | C |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3N6 |
C |
L39 K79 L80 |
L14 K54 L55 |
|
|
|
|