Structure of PDB 3mjp Chain C

Receptor sequence

>3mjpC (length=141) Species: 93934 (Coturnix japonica)

VLSAADKTNVKGIFAKIAGHAEEYGAEALDRMFTTYPQTKTYFPHFDVSH
GSAQIKGHGKKVAAALVEAANHIDDIAGTLSKLSDLHAQKLRVDPVNFKL
LGQCFLVVVAIHHPAALTPEVHASLDKFLCAVGTVLTAKYR

3D structure

• PDB: 3mjp Crystal structure determination of Japanese quail (Coturnix coturnix japonica) hemoglobin at 2.76 Angstrom resolution
• Chain: C
• Resolution: 2.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	M32 Y42 F43 H45 H58 K61 V62 H87 N97 F98	M32 Y42 F43 H45 H58 K61 V62 H87 N97 F98

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3mjp, PDBe:3mjp, PDBj:3mjp
• PDBsum: 3mjp
• UniProt: P24589|HBA_COTJA Hemoglobin subunit alpha-A (Gene Name=HBAA)