Structure of PDB 3mi9 Chain C

Receptor sequence
>3mi9C (length=49) Species: 11706 (HIV-1 M:B_HXB2R) [Search protein sequence]
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGR
3D structure
PDB3mi9 Crystal structure of HIV-1 Tat complexed with human P-TEFb.
ChainC
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN C C22 H33 C34 C37 C22 H33 C34 C37
BS02 ZN C C25 C30 C25 C30
Gene Ontology
Molecular Function
GO:0001070 RNA-binding transcription regulator activity
GO:0001223 transcription coactivator binding
GO:0003723 RNA binding
GO:0004865 protein serine/threonine phosphatase inhibitor activity
GO:0005515 protein binding
GO:0019904 protein domain specific binding
GO:0030332 cyclin binding
GO:0031491 nucleosome binding
GO:0035035 histone acetyltransferase binding
GO:0042805 actinin binding
GO:0043175 RNA polymerase core enzyme binding
GO:0046872 metal ion binding
GO:0140313 molecular sequestering activity
GO:0140537 transcription regulator activator activity
GO:1990970 trans-activation response element binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006915 apoptotic process
GO:0010801 negative regulation of peptidyl-threonine phosphorylation
GO:0019049 virus-mediated perturbation of host defense response
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039525 modulation by virus of host chromatin organization
GO:0039606 symbiont-mediated suppression of host translation initiation
GO:0042783 evasion of host immune response
GO:0050434 positive regulation of viral transcription
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0005576 extracellular region
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044196 host cell nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3mi9, PDBe:3mi9, PDBj:3mi9
PDBsum3mi9
PubMed20535204
UniProtP04608|TAT_HV1H2 Protein Tat (Gene Name=tat)

[Back to BioLiP]