Structure of PDB 3maa Chain C

Receptor sequence
>3maaC (length=328) Species: 9913 (Bos taurus) [Search protein sequence]
ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIETIV
AAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDE
GVRACYERSNEYQLIDCAQYFLDKIDVIKQDDYVPSDQDLLRCRVLTSGI
FETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVI
REDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSK
IEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRH
YCYPHFTCAVDTENIRRVFNDCRDIIQR
3D structure
PDB3maa Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
ChainC
Resolution3.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E50 T55 R201 D223 Q227
Catalytic site (residue number reindexed from 1) E12 T17 R144 D166 Q170
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG C S54 T204 S16 T147
BS02 GSP C E50 S51 G52 K53 S54 T55 D173 R199 R201 G226 N292 K293 D295 L296 C365 A366 V367 E12 S13 G14 K15 S16 T17 D116 R142 R144 G169 N235 K236 D238 L239 C308 A309 V310
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005159 insulin-like growth factor receptor binding
GO:0005525 GTP binding
GO:0010856 adenylate cyclase activator activity
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0031698 beta-2 adrenergic receptor binding
GO:0031748 D1 dopamine receptor binding
GO:0031852 mu-type opioid receptor binding
GO:0035255 ionotropic glutamate receptor binding
GO:0046872 metal ion binding
GO:0051430 corticotropin-releasing hormone receptor 1 binding
Biological Process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007606 sensory perception of chemical stimulus
GO:0071880 adenylate cyclase-activating adrenergic receptor signaling pathway
Cellular Component
GO:0005737 cytoplasm
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3maa, PDBe:3maa, PDBj:3maa
PDBsum3maa
PubMed19243146
UniProtP04896|GNAS2_BOVIN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short (Gene Name=GNAS)

[Back to BioLiP]