Structure of PDB 3m8y Chain C

Receptor sequence

>3m8yC (length=390) Species: 226900 (Bacillus cereus ATCC 14579)

KYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKL
GLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQ
VFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVY
TSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGE
PGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTE
SLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEAL
QEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPS
MKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL

3D structure

• PDB: 3m8y Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
• Chain: C
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 5.4.2.7: phosphopentomutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	C	T85 D156 D286 H291 H339	T83 D154 D284 H289 H337
BS02	MN	C	D13 T85 D327 H328	D11 T83 D325 H326
BS03	MN	C	G27 D28 H334	G25 D26 H332

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003824 catalytic activity
• GO:0008973 phosphopentomutase activity
• GO:0016853 isomerase activity
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006015 5-phosphoribose 1-diphosphate biosynthetic process
• GO:0006018 2-deoxyribose 1-phosphate catabolic process
• GO:0009117 nucleotide metabolic process
• GO:0043094 cellular metabolic compound salvage

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3m8y, PDBe:3m8y, PDBj:3m8y
• PDBsum: 3m8y
• PubMed: 21193409
• UniProt: Q818Z9|DEOB_BACCR Phosphopentomutase (Gene Name=deoB)