Structure of PDB 3lu1 Chain C

Receptor sequence

>3lu1C (length=334) Species: 703 (Plesiomonas shigelloides)

SRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTG
HQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALG
SVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPAL
PKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQD
PNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALA
KDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQ
ADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK

3D structure

• PDB: 3lu1 Altered architecture of substrate binding region defines the unique specificity of UDP-GalNAc 4-epimerases.
• Chain: C
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S142 S143 S144 Y166 K170 N204
• Catalytic site (residue number reindexed from 1): S140 S141 S142 Y164 K168 N202
• Enzyme Commision number: 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	C	G23 G26 F27 I28 D47 N48 S50 T51 G52 D78 I79 Q98 A99 A100 A140 A141 Y166 K170 Y193 V196	G21 G24 F25 I26 D45 N46 S48 T49 G50 D76 I77 Q96 A97 A98 A138 A139 Y164 K168 Y191 V194
BS02	UD2	C	S103 S142 S143 S144 Y166 N195 A209 V210 K213 Y225 I226 N227 R234 L271 R299 D302 V303	S101 S140 S141 S142 Y164 N193 A207 V208 K211 Y223 I224 N225 R232 L269 R292 D295 V296
BS03	GLY	C	N227 R296 R299	N225 R289 R292

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003974 UDP-N-acetylglucosamine 4-epimerase activity
• GO:0016853 isomerase activity

Biological Process

• GO:0009243 O antigen biosynthetic process

External links

• PDB: RCSB:3lu1, PDBe:3lu1, PDBj:3lu1
• PDBsum: 3lu1
• PubMed: 21384454
• UniProt: Q7BJX9|GNE_PLESH UDP-N-acetylglucosamine 4-epimerase (Gene Name=wbgU)