Structure of PDB 3lon Chain C

Receptor sequence

>3lonC (length=151)

VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNV
DQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLS
PRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETT
M

3D structure

• PDB: 3lon Candidate selection and preclinical evaluation culminating in the discovery of Narlaprevir (SCH 900518): A potent, selective and orally efficacious second generation HCV NS3 serine protease inhibitor
• Chain: C
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H29 D53 G109 S111
• Enzyme Commision number: 3.4.21.98: hepacivirin.
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	G31 A111 V113	G3 A83 V85
BS02	peptide	C	V29 G31 E32 V33 I35 V36 S37 R62 T63 I64 A65 P88 G90	V1 G3 E4 V5 I7 V8 S9 R34 T35 I36 A37 P60 G62
BS03	ZN	C	C97 C99 C145	C69 C71 C117

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:3lon, PDBe:3lon, PDBj:3lon
• PDBsum: 3lon
• UniProt: Q9ELS8