Structure of PDB 3lf0 Chain C

Receptor sequence
>3lf0C (length=101) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
HMKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRYSVDFVPKVRI
EVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDA
L
3D structure
PDB3lf0 Crystal structures of the apo and ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein.
ChainC
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP C G27 T29 V63 V64 R103 G28 T30 V52 V53 R92 MOAD: Kd=1.93uM
BS02 ATP C G35 Y36 G37 R38 K58 I86 G87 G89 K90 G36 Y37 G38 R39 K47 I75 G76 G78 K79 MOAD: Kd=1.93uM
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
GO:0043531 ADP binding
Biological Process
GO:0006808 regulation of nitrogen utilization
GO:0051701 biological process involved in interaction with host
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lf0, PDBe:3lf0, PDBj:3lf0
PDBsum3lf0
PubMed20521335
UniProtP9WN31|GLNB_MYCTU Nitrogen regulatory protein P-II (Gene Name=glnB)

[Back to BioLiP]