Structure of PDB 3lap Chain C

Receptor sequence
>3lapC (length=149) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGA
VKLRGADGGTGIYVVPEGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPP
GAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
3D structure
PDB3lap crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
ChainC
Resolution2.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R18 R21 T52 T55 R58 R3 R6 T37 T40 R43
BS02 dna C S36 Q37 Q53 A54 S57 K67 Y78 S21 Q22 Q38 A39 S42 K52 Y63
BS03 GGB C G145 D146 D147 T148 G124 D125 D126 T127
BS04 GGB C H125 D132 T142 H104 D111 T121
BS05 GGB C G122 D146 G101 D125
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0034618 arginine binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006525 arginine metabolic process
GO:0006526 L-arginine biosynthetic process
GO:0051259 protein complex oligomerization
GO:1900079 regulation of arginine biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lap, PDBe:3lap, PDBj:3lap
PDBsum3lap
PubMed20382162
UniProtP9WPY9|ARGR_MYCTU Arginine repressor (Gene Name=argR)

[Back to BioLiP]