Structure of PDB 3l70 Chain C

Receptor sequence

>3l70C (length=380) Species: 9031 (Gallus gallus) [Search protein sequence]

MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGL
LLAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIG
RGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNL
FSAIPYIGHTLVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTF
LHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNL
LGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVL
ILFLIPFLHKSKQRTMTFRPLSQTLFWLLVANLLILTWIGSQPVEHPFII
IGQMASLSYFTILLILFPTIGTLENKMLNY

3D structure

PDB

3l70 Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.

Chain

Resolution

2.75 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H202 S206 K228 D229 E272
Catalytic site (residue number reindexed from 1)	H202 S206 K228 D229 E272
Enzyme Commision number	1.10.2.2: Transferred entry: 7.1.1.8.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	C	Q45 G49 L50 A53 R81 H84 T127 G131 H183 F184 P187	Q45 G49 L50 A53 R81 H84 T127 G131 H183 F184 P187
BS02	HEM	C	W32 G35 L38 H98 I99 R101 S107 T113 W114 G117 L120 T194 H197 L198 L201 S206 N207	W32 G35 L38 H98 I99 R101 S107 T113 W114 G117 L120 T194 H197 L198 L201 S206 N207
BS03	JZV	C	M125 F129 Y132 G143 A144 I147 K270 P271 E272 Y274 F275 L295	M125 F129 Y132 G143 A144 I147 K270 P271 E272 Y274 F275 L295
BS04	UQ	C	L22 H202 S206 F221	L22 H202 S206 F221

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006979	response to oxidative stress
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3l70, PDBe:3l70, PDBj:3l70
PDBsum	3l70
PubMed
UniProt	P18946\|CYB_CHICK Cytochrome b (Gene Name=MT-CYB)

[Back to BioLiP]