Structure of PDB 3kn2 Chain C

Receptor sequence

>3kn2C (length=151)

VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNV
DQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLS
PRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETT
M

3D structure

• PDB: 3kn2 P4 capped amides and lactams as HCV NS3 protease inhibitors with improved potency and DMPK profile.
• Chain: C
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H29 D53 G109 S111
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	G31 A111 V113	G3 A83 V85
BS02	peptide	C	V29 G31 E32 V33 I35 V36 S37 R62 T63 I64 A65 P88 G90	V1 G3 E4 V5 I7 V8 S9 R34 T35 I36 A37 P60 G62
BS03	ZN	C	C97 C99 C145	C69 C71 C117

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:3kn2, PDBe:3kn2, PDBj:3kn2
• PDBsum: 3kn2
• PubMed: 20004570
• UniProt: P26664|POLG_HCV1 Genome polyprotein