Structure of PDB 3kik Chain C

Receptor sequence

>3kikC (length=93) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNI
NESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDT

3D structure

PDB

3kik Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1

Chain

Resolution

2.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	Q35 G37	Q33 G35
BS02	peptide	C	K9 I12 Q13 Y22 L29 L33 W38 T46 M50 F58 L62 E66 L70 R78 L82	K7 I10 Q11 Y20 L27 L31 W36 T44 M48 F56 L60 E64 L68 R76 L80

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding
GO:0003713	transcription coactivator activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity

	Biological Process
GO:0000973	post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006325	chromatin organization
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006368	transcription elongation by RNA polymerase II
GO:0006406	mRNA export from nucleus
GO:0015031	protein transport
GO:0016973	poly(A)+ mRNA export from nucleus
GO:0032880	regulation of protein localization
GO:0045893	positive regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051028	mRNA transport
GO:0071028	nuclear mRNA surveillance

	Cellular Component
GO:0000124	SAGA complex
GO:0000932	P-body
GO:0005634	nucleus
GO:0005643	nuclear pore
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0046695	SLIK (SAGA-like) complex
GO:0070390	transcription export complex 2
GO:0071819	DUBm complex

External links

PDB	RCSB:3kik, PDBe:3kik, PDBj:3kik
PDBsum	3kik
PubMed	20007317
UniProt	Q6WNK7\|SUS1_YEAST Transcription and mRNA export factor SUS1 (Gene Name=SUS1)