Structure of PDB 3kif Chain C |
>3kifC (length=85) Species: 32630 (synthetic construct) [Search protein sequence] |
KEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEI GSGGWSGFKFLFFHPNGYLYAVRGQRFYKALPPVS |
|
PDB | 3kif Metamorphic proteins mediate evolutionary transitions of structure |
Chain | C |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GDL |
C |
S70 G71 G72 W73 |
S52 G53 G54 W55 |
|
|
|