Structure of PDB 3k7v Chain C

Receptor sequence

>3k7vC (length=288) Species: 9606 (Homo sapiens) [Search protein sequence]

FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVC
GDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKV
RYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPL
TALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDD
RGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRN
VVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP

3D structure

PDB

3k7v A structural basis for the reduced toxicity of dinophysistoxin-2.

Chain

Resolution

2.85 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H167
Catalytic site (residue number reindexed from 1)	H162
Enzyme Commision number	3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	XT1	C	R89 H118 Q122 I123 Y127 H191 W200 R214 L243 Y265	R84 H113 Q117 I118 Y122 H186 W195 R209 L238 Y260
BS02	MN	C	D85 N117 H167 H241	D80 N112 H162 H236
BS03	MN	C	D57 H59 D85	D52 H54 D80

Gene Ontology

	Molecular Function
GO:0004721	phosphoprotein phosphatase activity
GO:0004722	protein serine/threonine phosphatase activity
GO:0004725	protein tyrosine phosphatase activity
GO:0005515	protein binding
GO:0016787	hydrolase activity
GO:0017018	myosin phosphatase activity
GO:0046872	metal ion binding
GO:0046982	protein heterodimerization activity
GO:0048156	tau protein binding
GO:0050811	GABA receptor binding

	Biological Process
GO:0000278	mitotic cell cycle
GO:0001932	regulation of protein phosphorylation
GO:0006470	protein dephosphorylation
GO:0007498	mesoderm development
GO:0010288	response to lead ion
GO:0010719	negative regulation of epithelial to mesenchymal transition
GO:0035331	negative regulation of hippo signaling
GO:0035556	intracellular signal transduction
GO:0035970	peptidyl-threonine dephosphorylation
GO:0040008	regulation of growth
GO:0043029	T cell homeostasis
GO:0045595	regulation of cell differentiation
GO:0051321	meiotic cell cycle
GO:0051898	negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070262	peptidyl-serine dephosphorylation
GO:0071902	positive regulation of protein serine/threonine kinase activity
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly
GO:1904526	regulation of microtubule binding
GO:1904528	positive regulation of microtubule binding
GO:1904539	negative regulation of glycolytic process through fructose-6-phosphate
GO:2000045	regulation of G1/S transition of mitotic cell cycle

	Cellular Component
GO:0000159	protein phosphatase type 2A complex
GO:0000775	chromosome, centromeric region
GO:0000922	spindle pole
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0008287	protein serine/threonine phosphatase complex
GO:0015630	microtubule cytoskeleton
GO:0016020	membrane
GO:0045121	membrane raft
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:0090443	FAR/SIN/STRIPAK complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3k7v, PDBe:3k7v, PDBj:3k7v
PDBsum	3k7v
PubMed	19916524
UniProt	P67775\|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (Gene Name=PPP2CA)

[Back to BioLiP]