Structure of PDB 3k0j Chain C |
>3k0jC (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] |
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRG QAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKT |
|
PDB | 3k0j Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch. |
Chain | C |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
C |
E425 K428 |
E22 K25 |
PDBbind-CN: Kd=8.65nM |
|
|
|