Structure of PDB 3jct Chain C

Receptor sequence

>3jctC (length=361) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYA
VSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFA
PTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLV
VSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQ
RRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWT
EAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRP
AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKP
AAVFTETLKHD

3D structure

PDB

3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes

Chain

Resolution

3.08 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R31 H36 T40 N43 K44 N45 K46 R47 Q48 Y50 V52 S53 A56 H58 Q59 T60 S61 T67 A70 V71 A72 R73 I74 P75 G81 T82 R84 Q87 N92 M93 C94 R95 G96 R98 M99 F100 A101 K104 R107 K108 K112 N114 H115 E117 K118 R119 R138 R141 K161 T162 K163 K180 K183 K186 L187 R188 A189 G190 K191 K193 Y194 R195 R197 R202 R203 Y209 K217 R220 N221 P223 T227 L233 N234 P240 G241 H243 K271 V272 I290 R300 G303 A305 Q307 K308 R309 V312 L313 K315 K319 K321 Q322 R326 N328 A331 F334 A335 G340 S341 K342 K343 T347 T349	R30 H35 T39 N42 K43 N44 K45 R46 Q47 Y49 V51 S52 A55 H57 Q58 T59 S60 T66 A69 V70 A71 R72 I73 P74 G80 T81 R83 Q86 N91 M92 C93 R94 G95 R97 M98 F99 A100 K103 R106 K107 K111 N113 H114 E116 K117 R118 R137 R140 K160 T161 K162 K179 K182 K185 L186 R187 A188 G189 K190 K192 Y193 R194 R196 R201 R202 Y208 K216 R219 N220 P222 T226 L232 N233 P239 G240 H242 K270 V271 I289 R299 G302 A304 Q306 K307 R308 V311 L312 K314 K318 K320 Q321 R325 N327 A330 F333 A334 G339 S340 K341 K342 T346 T348
BS02	rna	C	A49 A51 S53 T105 K193 Y194	A48 A50 S52 T104 K192 Y193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jct, PDBe:3jct, PDBj:3jct
PDBsum	3jct
PubMed	27251291
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]