Structure of PDB 3jam Chain C

Receptor sequence

>3jamC (length=217) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNI
KPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAK
LSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPA
VKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQ
ALTPSPMDVYADYATAS

3D structure

PDB

3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.

Chain

Resolution

3.46 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	V91 Q92 K93 Q94 T95 R96 A97 Q99 R100 K104 K124 S164 K166 G168 S169 R173 A185 S186 Y202 T203 S205 T206 S208 T209 R210 T211 N214 K217 F229	V53 Q54 K55 Q56 T57 R58 A59 Q61 R62 K66 K86 S126 K128 G130 S131 R135 A147 S148 Y164 T165 S167 T168 S170 T171 R172 T173 N176 K179 F191

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jam, PDBe:3jam, PDBj:3jam
PDBsum	3jam
PubMed	26212456
UniProt	Q6CKL3

[Back to BioLiP]