Structure of PDB 3jag Chain C

Receptor sequence

>3jagC (length=362) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

ACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQP
YAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM
FAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELP
LVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRR
IQRRGPCVIYNEDNGIVKAFRNIPGITLLNVTKLNILKLAPGGHVGRFCI
WTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRA
LRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRV
ERAAAALAAKSD

3D structure

PDB

3jag Structural basis for stop codon recognition in eukaryotes.

Chain

Resolution

3.65 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R33 N38 F39 T42 R45 K46 N48 R49 Q50 Y52 V54 S55 A58 H60 Q61 T62 S63 S66 T69 G70 A72 V73 A74 R75 R78 R80 G83 T84 H85 R86 Q89 N94 M95 C96 R97 R100 M101 F102 A103 K106 W108 R109 R110 R114 N116 T118 Q119 K120 R121 K140 R143 K163 T164 K165 K172 W177 K181 K182 Y184 R188 M189 R190 A191 G192 K193 K195 M196 R197 R199 R204 R205 K219 R222 N223 K234 L235 N236 P242 G243 H245 R268 K274 S275 R291 K294 Q299 R303 P305 R306 K307 K308 R311 R312 L314 K316 N321 L322 R323 L326 K327 K333 M335 R336 T339 R342 Q343 N346 H347	R32 N37 F38 T41 R44 K45 N47 R48 Q49 Y51 V53 S54 A57 H59 Q60 T61 S62 S65 T68 G69 A71 V72 A73 R74 R77 R79 G82 T83 H84 R85 Q88 N93 M94 C95 R96 R99 M100 F101 A102 K105 W107 R108 R109 R113 N115 T117 Q118 K119 R120 K139 R142 K162 T163 K164 K171 W176 K180 K181 Y183 R187 M188 R189 A190 G191 K192 K194 M195 R196 R198 R203 R204 K218 R221 N222 K233 L234 N235 P241 G242 H244 R267 K273 S274 R290 K293 Q298 R302 P304 R305 K306 K307 R310 R311 L313 K315 N320 L321 R322 L325 K326 K332 M334 R335 T338 R341 Q342 N345 H346
BS02	rna	C	P51 A53 S55 T107 M196	P50 A52 S54 T106 M195

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jag, PDBe:3jag, PDBj:3jag
PDBsum	3jag
PubMed	26245381
UniProt	G1SVW5\|RL4_RABIT Large ribosomal subunit protein uL4 (Gene Name=RPL4)

[Back to BioLiP]