Structure of PDB 3j6b Chain C

Receptor sequence

>3j6bC (length=249) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

STRPFLVAPSIANSITTEAPAINHSPELANARKWLPKRCGLITRKKGMMP
YFDKSTGERSAATILEVNNVEVIMHRTSEVNGYFACQVGYGSRHLSKVSR
QMLGHFASKVVNPKEHVAEFRVKDEKGLIPPGTLLKPSFFKEGQYVDVRS
VSKGKGFTGVMKRYGFKGLRASHGTSIMHRHGGSYGQNQDPGRVLPGRKM
PGHMGNEHVTIQNVKVLKVDDENNVIWVKGSVAGPKNSFVKIQDAIKKT

3D structure

PDB

3j6b Structure of the yeast mitochondrial large ribosomal subunit.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R23 H44 R52 K53 W54 K65 M68 M69 P70 R79 A81 M94 R96 Y103 Q107 R113 H114 K117 S119 R120 Q121 M122 G124 H125 S128 K129 E139 R141 R169 S172 K173 G174 K175 G176 F177 G179 M181 K182 R183 F186 K187 G188 L189 A191 S192 H193 G194 T195 S196 I197 M198 H199 R200 H201 G202 G203 S204 Y205 G206 Q207 N208 Q209 D210 P211 G212 R213 V214 L215 G217 R218 M220 P221 H223 E227 H228 T230 I231 Q232 N233 K249 S251 A253 G254 P255 K267	R3 H24 R32 K33 W34 K45 M48 M49 P50 R59 A61 M74 R76 Y83 Q87 R93 H94 K97 S99 R100 Q101 M102 G104 H105 S108 K109 E119 R121 R149 S152 K153 G154 K155 G156 F157 G159 M161 K162 R163 F166 K167 G168 L169 A171 S172 H173 G174 T175 S176 I177 M178 H179 R180 H181 G182 G183 S184 Y185 G186 Q187 N188 Q189 D190 P191 G192 R193 V194 L195 G197 R198 M200 P201 H203 E207 H208 T210 I211 Q212 N213 K229 S231 A233 G234 P235 K247

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum	3j6b
PubMed	24675956
UniProt	P31334\|RM09_YEAST Large ribosomal subunit protein uL3m (Gene Name=MRPL9)

[Back to BioLiP]